Lineage for d4fcfa_ (4fcf A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013003Protein beta-Lactamase, class A [56606] (16 species)
  7. 3013194Species Klebsiella pneumoniae, SHV-1 [TaxId:573] [56609] (27 PDB entries)
    inhibited by tazobactam
    Uniprot Q5PSW7 ! Uniprot P14557 22-286
  8. 3013195Domain d4fcfa_: 4fcf A: [194186]
    automated match to d1onga_
    complexed with ma4, tau

Details for d4fcfa_

PDB Entry: 4fcf (more details), 1.09 Å

PDB Description: K234R: apo structure of inhibitor resistant beta-lactamase
PDB Compounds: (A:) Beta-lactamase SHV-1

SCOPe Domain Sequences for d4fcfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fcfa_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-1 [TaxId: 573]}
spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd
agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
agltaflrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsarsqr
qllqwmvddrvagplirsvlpagwfiadrtgagergargivallgpnnkaerivviylrd
tpasmaernqqiagigaaliehwqr

SCOPe Domain Coordinates for d4fcfa_:

Click to download the PDB-style file with coordinates for d4fcfa_.
(The format of our PDB-style files is described here.)

Timeline for d4fcfa_: