PDB entry 4fcf

View 4fcf on RCSB PDB site
Description: K234R: apo structure of inhibitor resistant beta-lactamase
Class: hydrolase/hydrolase inhibitor
Keywords: class A beta-lactamse, hydrolase-hydrolase inhibitor complex
Deposited on 2012-05-24, released 2012-12-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-10-02, with a file datestamp of 2013-09-27.
Experiment type: XRAY
Resolution: 1.09 Å
R-factor: 0.124
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase SHV-1
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: bla, shv1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AD64 (0-264)
      • engineered mutation (208)
    Domains in SCOPe 2.08: d4fcfa_
  • Heterogens: MA4, TAU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fcfA (A:)
    spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd
    agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
    agltaflrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsarsqr
    qllqwmvddrvagplirsvlpagwfiadrtgagergargivallgpnnkaerivviylrd
    tpasmaernqqiagigaaliehwqr