Lineage for d4ewja1 (4ewj A:1-137)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
beta(3)-alpha(3); meander and up-and-down bundleSuperfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) 
Family d.54.1.0: automated matches [227195] (1 protein)
not a true familyProtein automated matches [226922] (94 species)
not a true protein
Species Streptococcus suis [TaxId:1307] [226501] (1 PDB entry) 
Domain d4ewja1: 4ewj A:1-137 [220893]
Other proteins in same PDB: d4ewja2, d4ewjb2
automated match to d1w6ta2
Details for d4ewja1
PDB Entry: 4ewj (more details), 2.4 Å
PDB Description: structure of the enloase from Streptococcus suis serotype 2
PDB Compounds: (A:) Enolase 2SCOPe Domain Sequences for d4ewja1:
Sequence, based on SEQRES records: (download)
>d4ewja1 d.54.1.0 (A:1-137) automated matches {Streptococcus suis [TaxId: 1307]}
msiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksryl
glgtqkavdnvnnviadaiigfdvrdqqaidramialdgtpnkgklganailgvsiavar
aaadylevplytylggf
Sequence, based on observed residues (ATOM records): (download)
>d4ewja1 d.54.1.0 (A:1-137) automated matches {Streptococcus suis [TaxId: 1307]}
msiitdvyarevldsrgnptlevevytesgafgrgmvpsggeheavelrdgdksrylglg
tqkavdnvnnviadaiigfdvrdqqaidramialdgtpnkgklganailgvsiavaraaa
dylevplytylggf
SCOPe Domain Coordinates for d4ewja1:
Click to download the PDB-style file with coordinates for d4ewja1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ewja1:
- d4ewja1 first appeared in SCOPe 2.03
- d4ewja1 appears in SCOPe 2.06
- d4ewja1 appears in the current release, SCOPe 2.08
View in 3D
