![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (55 species) not a true protein |
![]() | Species Streptococcus suis [TaxId:1307] [226501] (1 PDB entry) |
![]() | Domain d4ewja1: 4ewj A:1-137 [220893] Other proteins in same PDB: d4ewja2, d4ewjb2 automated match to d1w6ta2 |
PDB Entry: 4ewj (more details), 2.4 Å
SCOPe Domain Sequences for d4ewja1:
Sequence, based on SEQRES records: (download)
>d4ewja1 d.54.1.0 (A:1-137) automated matches {Streptococcus suis [TaxId: 1307]} msiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksryl glgtqkavdnvnnviadaiigfdvrdqqaidramialdgtpnkgklganailgvsiavar aaadylevplytylggf
>d4ewja1 d.54.1.0 (A:1-137) automated matches {Streptococcus suis [TaxId: 1307]} msiitdvyarevldsrgnptlevevytesgafgrgmvpsggeheavelrdgdksrylglg tqkavdnvnnviadaiigfdvrdqqaidramialdgtpnkgklganailgvsiavaraaa dylevplytylggf
Timeline for d4ewja1: