| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (73 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:388272] [226355] (3 PDB entries) |
| Domain d4ecja2: 4ecj A:82-203 [220419] Other proteins in same PDB: d4ecja1, d4ecja3, d4ecjb1, d4ecjb3 automated match to d1k0db1 complexed with gsh |
PDB Entry: 4ecj (more details), 1.76 Å
SCOPe Domain Sequences for d4ecja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ecja2 a.45.1.0 (A:82-203) automated matches {Pseudomonas aeruginosa [TaxId: 388272]}
lmpadvkgrsrviqwlmfqmggvgpmqgqanvffryfpeklqgaidryqhetrrlyevld
grlgeaeylagdysiadiatypwvrihdwsgvavdgldnlqrwiaaiearpavqrgllvp
rr
Timeline for d4ecja2: