SCOPe 2.08: Domain d4ecjb2: 4ecj B:82-202

Lineage for d4ecjb2 (4ecj B:82-202)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:388272] [226355] (3 PDB entries)

8. Domain d4ecjb2: 4ecj B:82-202 [220421]
   Other proteins in same PDB: d4ecja1, d4ecja3, d4ecjb1, d4ecjb3
   automated match to d1k0db1
   complexed with gsh

Details for d4ecjb2

PDB Entry: 4ecj, 1.76 Å

PDB Description: Crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d4ecjb2:

Sequence; same for both SEQRES and ATOM records:

>d4ecjb2 a.45.1.0 (B:82-202) automated matches {Pseudomonas aeruginosa [TaxId: 388272]}
lmpadvkgrsrviqwlmfqmggvgpmqgqanvffryfpeklqgaidryqhetrrlyevld
grlgeaeylagdysiadiatypwvrihdwsgvavdgldnlqrwiaaiearpavqrgllvp
r

Timeline for d4ecjb2:

• d4ecjb2 first appeared in SCOPe 2.03
  
• d4ecjb2 appears in SCOPe 2.07