Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
Protein FKBP52, N-terminal domains [82619] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82620] (10 PDB entries) Uniprot Q02790 21-427; contains tandem repeat of two FKPB domains |
Domain d4drja_: 4drj A: [193739] Other proteins in same PDB: d4drjb_ automated match to d1n1aa_ complexed with rap, so4 |
PDB Entry: 4drj (more details), 1.8 Å
SCOPe Domain Sequences for d4drja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4drja_ d.26.1.1 (A:) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} pmegvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdssldrkdkfs fdlgkgevikawdiaiatmkvgevchitckpeyaygsagsppkippnatlvfevelfefk g
Timeline for d4drja_: