Lineage for d4drja_ (4drj A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199823Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1199824Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1199825Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 1199998Protein automated matches [191209] (3 species)
    not a true protein
  7. 1200001Species Human (Homo sapiens) [TaxId:9606] [189839] (4 PDB entries)
  8. 1200005Domain d4drja_: 4drj A: [193739]
    automated match to d1n1aa_
    complexed with rap, so4

Details for d4drja_

PDB Entry: 4drj (more details), 1.8 Å

PDB Description: o-crystal structure of the PPIase domain of FKBP52, Rapamycin and the FRB fragment of mTOR
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP4

SCOPe Domain Sequences for d4drja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4drja_ d.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pmegvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdssldrkdkfs
fdlgkgevikawdiaiatmkvgevchitckpeyaygsagsppkippnatlvfevelfefk
g

SCOPe Domain Coordinates for d4drja_:

Click to download the PDB-style file with coordinates for d4drja_.
(The format of our PDB-style files is described here.)

Timeline for d4drja_: