Lineage for d4dj4a_ (4dj4 A:)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
multihelicalSuperfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) 
duplication: all chain but the N-terminal helix forms two structural repeats
Family a.124.1.0: automated matches [194368] (1 protein)
not a true familyProtein automated matches [194369] (2 species)
not a true protein
Species Solanum lycopersicum [TaxId:4081] [194382] (3 PDB entries) 
Domain d4dj4a_: 4dj4 A: [194387]
automated match to d1ak0a_
complexed with cl, na, zn; mutant
Details for d4dj4a_
PDB Entry: 4dj4 (more details), 2.35 Å
PDB Description: x-ray structure of mutant n211d of bifunctional nuclease tbn1 from solanum lycopersicum (tomato)
PDB Compounds: (A:) NucleaseSCOPe Domain Sequences for d4dj4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dj4a_ a.124.1.0 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]}
wskeghvmtcriaqgllndeaahavkmllpeyvngdlsalcvwpdqvrhwykykwtsplh
fidtpdkacnfdyerdchdqhgvkdmcvagaiqnfttqlshyregtsdrrynmteallfl
shfmgdihqpmhvgftsdaggnsidlrwfrhksnlhhvwdreiiltaakdyyakdinlle
ediegdftdgiwsddlaswrecgnvfscvnkfatesiniackwgykgveagetlsddyfn
srlpivmkrvaqggirlamllnnvfg
SCOPe Domain Coordinates for d4dj4a_:
Click to download the PDB-style file with coordinates for d4dj4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4dj4a_:
- d4dj4a_ first appeared in SCOPe 2.02
- d4dj4a_ appears in SCOPe 2.03
- d4dj4a_ appears in SCOPe 2.05
- d4dj4a_ appears in the current release, SCOPe 2.08
View in 3D
