Class a: All alpha proteins [46456] (284 folds) |
Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily) multihelical |
Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) duplication: all chain but the N-terminal helix forms two structural repeats |
Family a.124.1.0: automated matches [194368] (1 protein) not a true family |
Protein automated matches [194369] (2 species) not a true protein |
Species Solanum lycopersicum [TaxId:4081] [194382] (3 PDB entries) |
Domain d4dj4a_: 4dj4 A: [194387] automated match to d1ak0a_ complexed with cl, na, zn; mutant |
PDB Entry: 4dj4 (more details), 2.35 Å
SCOPe Domain Sequences for d4dj4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dj4a_ a.124.1.0 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]} wskeghvmtcriaqgllndeaahavkmllpeyvngdlsalcvwpdqvrhwykykwtsplh fidtpdkacnfdyerdchdqhgvkdmcvagaiqnfttqlshyregtsdrrynmteallfl shfmgdihqpmhvgftsdaggnsidlrwfrhksnlhhvwdreiiltaakdyyakdinlle ediegdftdgiwsddlaswrecgnvfscvnkfatesiniackwgykgveagetlsddyfn srlpivmkrvaqggirlamllnnvfg
Timeline for d4dj4a_: