Lineage for d4chsb2 (4chs B:84-219)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2326952Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2326953Protein automated matches [226831] (71 species)
    not a true protein
  7. 2327380Species Soybean (Glycine max) [TaxId:3847] [225580] (5 PDB entries)
  8. 2327384Domain d4chsb2: 4chs B:84-219 [261754]
    Other proteins in same PDB: d4chsa1, d4chsb1
    automated match to d2vo4a2
    complexed with acn, gs8

Details for d4chsb2

PDB Entry: 4chs (more details), 1.6 Å

PDB Description: crystal structure of a tau class glutathione transferase 10 from glycine max
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d4chsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4chsb2 a.45.1.0 (B:84-219) automated matches {Soybean (Glycine max) [TaxId: 3847]}
llpsdpyqraqarfwadyvdikihdlgkkiwtskgeekeaakkefiealklleeqlgdkt
yfggdnigfvdialvpfytwfkvyetfgslnienecprfvawakrclqkesvakslpdqh
kvyefvveirkklvie

SCOPe Domain Coordinates for d4chsb2:

Click to download the PDB-style file with coordinates for d4chsb2.
(The format of our PDB-style files is described here.)

Timeline for d4chsb2:

2327384
d4chsb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4chsb1