Lineage for d4cddd_ (4cdd D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1552675Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1553228Superfamily b.61.5: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75001] (2 families) (S)
    automatically mapped to Pfam PF08773
  5. 1553229Family b.61.5.1: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75002] (1 protein)
  6. 1553230Protein Dipeptidyl peptidase I (cathepsin C), exclusion domain [75003] (2 species)
  7. 1553231Species Human (Homo sapiens) [TaxId:9606] [75004] (7 PDB entries)
  8. 1553236Domain d4cddd_: 4cdd D: [237780]
    automated match to d1k3ba_
    complexed with cl, gdi, nag

Details for d4cddd_

PDB Entry: 4cdd (more details), 2.35 Å

PDB Description: human dpp1 in complex with (2s)-n-((1s)-1-cyano-2-(4-(4-cyanophenyl) phenyl)ethyl)piperidine-2-carboxamide
PDB Compounds: (D:) dipeptidyl peptidase 1 exclusion domain chain

SCOPe Domain Sequences for d4cddd_:

Sequence, based on SEQRES records: (download)

>d4cddd_ b.61.5.1 (D:) Dipeptidyl peptidase I (cathepsin C), exclusion domain {Human (Homo sapiens) [TaxId: 9606]}
dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkvgt

Sequence, based on observed residues (ATOM records): (download)

>d4cddd_ b.61.5.1 (D:) Dipeptidyl peptidase I (cathepsin C), exclusion domain {Human (Homo sapiens) [TaxId: 9606]}
dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
tiiynqgfeivlndykwfaffkykvttycnetmtgwvhdvlgrnwacftgkkvgt

SCOPe Domain Coordinates for d4cddd_:

Click to download the PDB-style file with coordinates for d4cddd_.
(The format of our PDB-style files is described here.)

Timeline for d4cddd_: