Class b: All beta proteins [48724] (176 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.5: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75001] (2 families) automatically mapped to Pfam PF08773 |
Family b.61.5.1: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75002] (1 protein) |
Protein Dipeptidyl peptidase I (cathepsin C), exclusion domain [75003] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [75004] (7 PDB entries) |
Domain d4cddd_: 4cdd D: [237780] automated match to d1k3ba_ complexed with cl, gdi, nag |
PDB Entry: 4cdd (more details), 2.35 Å
SCOPe Domain Sequences for d4cddd_:
Sequence, based on SEQRES records: (download)
>d4cddd_ b.61.5.1 (D:) Dipeptidyl peptidase I (cathepsin C), exclusion domain {Human (Homo sapiens) [TaxId: 9606]} dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkvgt
>d4cddd_ b.61.5.1 (D:) Dipeptidyl peptidase I (cathepsin C), exclusion domain {Human (Homo sapiens) [TaxId: 9606]} dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf tiiynqgfeivlndykwfaffkykvttycnetmtgwvhdvlgrnwacftgkkvgt
Timeline for d4cddd_: