PDB entry 4cdd
View 4cdd on RCSB PDB site
Description: Human DPP1 in complex with (2S)-N-((1S)-1-cyano-2-(4-(4-cyanophenyl) phenyl)ethyl)piperidine-2-carboxamide
Class: hydrolase
Keywords: hydrolase, inhibitor
Deposited on
2013-10-31, released
2014-03-19
The last revision prior to the SCOPe 2.04 freeze date was dated
2014-04-09, with a file datestamp of
2014-04-04.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.18915
AEROSPACI score: 0.29
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: dipeptidyl peptidase 1 exclusion domain chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d4cdda_ - Chain 'B':
Compound: dipeptidyl peptidase 1 heavy chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: dipeptidyl peptidase 1 light chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: dipeptidyl peptidase 1 exclusion domain chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d4cddd_ - Chain 'E':
Compound: dipeptidyl peptidase 1 heavy chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: dipeptidyl peptidase 1 light chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Heterogens: NAG, GDI, CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4cddA (A:)
dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkvgt
Sequence, based on observed residues (ATOM records): (download)
>4cddA (A:)
dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkv
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence, based on SEQRES records: (download)
>4cddD (D:)
dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkvgt
Sequence, based on observed residues (ATOM records): (download)
>4cddD (D:)
dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
tiiynqgfeivlndykwfaffkykvttycnetmtgwvhdvlgrnwacftgkkvgt
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.