Lineage for d4c29a_ (4c29 A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.62: vWA-like [53299] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the restSuperfamily c.62.1: vWA-like [53300] (6 families) 
Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) 
Protein automated matches [190060] (2 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [186779] (23 PDB entries) 
Domain d4c29a_: 4c29 A: [235848]
automated match to d1auqa_
complexed with act, ca, peg; mutant
Details for d4c29a_
PDB Entry: 4c29 (more details), 2.2 Å
PDB Description: Crystal Structure of High-Affinity von Willebrand Factor A1 domain with Disulfide Mutation
PDB Compounds: (A:) von willebrand factorSCOPe Domain Sequences for d4c29a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c29a_ c.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plhdfcrsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgs
hayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllm
asqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvde
leqqrdeivsylcdlapeapp
SCOPe Domain Coordinates for d4c29a_:
Click to download the PDB-style file with coordinates for d4c29a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4c29a_:
- d4c29a_ first appeared in SCOPe 2.03
- d4c29a_ appears in SCOPe 2.06
- d4c29a_ appears in the current release, SCOPe 2.08
View in 3D
