Lineage for d4c29a_ (4c29 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378146Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1378147Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 1378148Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 1378280Protein automated matches [190060] (1 species)
    not a true protein
  7. 1378281Species Human (Homo sapiens) [TaxId:9606] [186779] (10 PDB entries)
  8. 1378294Domain d4c29a_: 4c29 A: [235848]
    automated match to d1auqa_
    complexed with act, ca, peg; mutant

Details for d4c29a_

PDB Entry: 4c29 (more details), 2.2 Å

PDB Description: Crystal Structure of High-Affinity von Willebrand Factor A1 domain with Disulfide Mutation
PDB Compounds: (A:) von willebrand factor

SCOPe Domain Sequences for d4c29a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c29a_ c.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plhdfcrsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgs
hayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllm
asqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvde
leqqrdeivsylcdlapeapp

SCOPe Domain Coordinates for d4c29a_:

Click to download the PDB-style file with coordinates for d4c29a_.
(The format of our PDB-style files is described here.)

Timeline for d4c29a_: