Lineage for d4adbc_ (4adb C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897106Species Escherichia coli [TaxId:511693] [234051] (4 PDB entries)
  8. 2897109Domain d4adbc_: 4adb C: [234054]
    automated match to d3nx3a_
    complexed with mg, na, plp

Details for d4adbc_

PDB Entry: 4adb (more details), 2.2 Å

PDB Description: Structural and functional study of succinyl-ornithine transaminase from E. coli
PDB Compounds: (C:) succinylornithine transaminase

SCOPe Domain Sequences for d4adbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4adbc_ c.67.1.0 (C:) automated matches {Escherichia coli [TaxId: 511693]}
pitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpelrea
lneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfahdr
ygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasalidds
tcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymhygv
tpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelintpe
mlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaakagv
mvliaggnvvrfapalnvseeevttgldrfaaacehfvs

SCOPe Domain Coordinates for d4adbc_:

Click to download the PDB-style file with coordinates for d4adbc_.
(The format of our PDB-style files is described here.)

Timeline for d4adbc_: