SCOPe 2.08: Domain d4adbb_: 4adb B:

Lineage for d4adbb_ (4adb B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (166 species)
   not a true protein

7. Species Escherichia coli [TaxId:511693] [234051] (4 PDB entries)

8. Domain d4adbb_: 4adb B: [234053]
   automated match to d3nx3a_
   complexed with mg, na, plp

Details for d4adbb_

PDB Entry: 4adb, 2.2 Å

PDB Description: Structural and functional study of succinyl-ornithine transaminase from E. coli

PDB Compounds: (B:) succinylornithine transaminase

SCOPe Domain Sequences for d4adbb_:

Sequence; same for both SEQRES and ATOM records:

>d4adbb_ c.67.1.0 (B:) automated matches {Escherichia coli [TaxId: 511693]}
qpitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpelre
alneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfahd
rygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasalidd
stcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymhyg
vtpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelintp
emlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaakag
vmvliaggnvvrfapalnvseeevttgldrfaaacehfvsr

Timeline for d4adbb_:

• d4adbb_ first appeared in SCOPe 2.03
  
• d4adbb_ appears in SCOPe 2.07