PDB entry 4adb

View 4adb on RCSB PDB site
Description: Structural and functional study of succinyl-ornithine transaminase from E. coli
Class: transferase
Keywords: transferase, plp enzymes, aminotransferase
Deposited on 2011-12-23, released 2013-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17323
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: succinylornithine transaminase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4adba_
  • Chain 'B':
    Compound: succinylornithine transaminase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4adbb_
  • Chain 'C':
    Compound: succinylornithine transaminase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4adbc_
  • Chain 'D':
    Compound: succinylornithine transaminase
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4adbd_
  • Heterogens: PLP, NA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4adbA (A:)
    msqpitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpel
    realneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfa
    hdrygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasali
    ddstcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymh
    ygvtpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelin
    tpemlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaak
    agvmvliaggnvvrfapalnvseeevttgldrfaaacehfvsrgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4adbA (A:)
    qpitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpelre
    alneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfahd
    rygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasalidd
    stcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymhyg
    vtpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelintp
    emlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaakag
    vmvliaggnvvrfapalnvseeevttgldrfaaacehfvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4adbB (B:)
    msqpitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpel
    realneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfa
    hdrygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasali
    ddstcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymh
    ygvtpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelin
    tpemlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaak
    agvmvliaggnvvrfapalnvseeevttgldrfaaacehfvsrgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4adbB (B:)
    qpitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpelre
    alneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfahd
    rygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasalidd
    stcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymhyg
    vtpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelintp
    emlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaakag
    vmvliaggnvvrfapalnvseeevttgldrfaaacehfvsr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4adbC (C:)
    msqpitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpel
    realneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfa
    hdrygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasali
    ddstcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymh
    ygvtpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelin
    tpemlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaak
    agvmvliaggnvvrfapalnvseeevttgldrfaaacehfvsrgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4adbC (C:)
    pitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpelrea
    lneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfahdr
    ygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasalidds
    tcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymhygv
    tpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelintpe
    mlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaakagv
    mvliaggnvvrfapalnvseeevttgldrfaaacehfvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4adbD (D:)
    msqpitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpel
    realneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfa
    hdrygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasali
    ddstcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymh
    ygvtpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelin
    tpemlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaak
    agvmvliaggnvvrfapalnvseeevttgldrfaaacehfvsrgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4adbD (D:)
    qpitrenfdewmipvyapapfipvrgegsrlwdqqgkeyidfaggiavnalghahpelre
    alneqaskfwhtgngytnepvlrlakklidatfadrvffcnsgaeaneaalklarkfahd
    rygshksgivafknafhgrtlftvsaggqpaysqdfaplpadirhaayndinsasalidd
    stcavivepiqgeggvvpasnaflqglrelcnrhnallifdevqtgvgrtgelyaymhyg
    vtpdllttakalgggfpvgallateecarvmtvgthgttyggnplasavagkvlelintp
    emlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqakqisqeaakag
    vmvliaggnvvrfapalnvseeevttgldrfaaacehfvs