Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (6 species) not a true protein |
Species Enterococcus faecalis [TaxId:1351] [189861] (7 PDB entries) |
Domain d4a02a_: 4a02 A: [186686] automated match to d2bema_ |
PDB Entry: 4a02 (more details), 0.95 Å
SCOPe Domain Sequences for d4a02a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a02a_ b.1.18.0 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]} hgyvaspgsraffgssaggnlntnvgraqwepqsieapkntfitgklasagvsgfeplde qtatrwhktnittgplditwnltaqhrtaswdyyitkngwnpnqpldiknfdkiasidgk qevpnkvvkqtiniptdrkgyhviyavwgigdtvnafyqaidvniq
Timeline for d4a02a_: