Lineage for d4a02a_ (4a02 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766250Species Enterococcus faecalis [TaxId:1351] [189861] (7 PDB entries)
  8. 2766251Domain d4a02a_: 4a02 A: [186686]
    automated match to d2bema_

Details for d4a02a_

PDB Entry: 4a02 (more details), 0.95 Å

PDB Description: X-ray crystallographic structure of EfCBM33A
PDB Compounds: (A:) chitin binding protein

SCOPe Domain Sequences for d4a02a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a02a_ b.1.18.0 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]}
hgyvaspgsraffgssaggnlntnvgraqwepqsieapkntfitgklasagvsgfeplde
qtatrwhktnittgplditwnltaqhrtaswdyyitkngwnpnqpldiknfdkiasidgk
qevpnkvvkqtiniptdrkgyhviyavwgigdtvnafyqaidvniq

SCOPe Domain Coordinates for d4a02a_:

Click to download the PDB-style file with coordinates for d4a02a_.
(The format of our PDB-style files is described here.)

Timeline for d4a02a_: