| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (239 species) not a true protein |
| Species Enterococcus mundtii [TaxId:53346] [259610] (2 PDB entries) |
| Domain d3wsva1: 3wsv A:1-147 [260129] Other proteins in same PDB: d3wsva2, d3wsva3, d3wsvb2, d3wsvb3, d3wsvc2, d3wsvc3, d3wsvd2, d3wsvd3 automated match to d4ln1a1 complexed with gol |
PDB Entry: 3wsv (more details), 2.38 Å
SCOPe Domain Sequences for d3wsva1:
Sequence, based on SEQRES records: (download)
>d3wsva1 c.2.1.0 (A:1-147) automated matches {Enterococcus mundtii [TaxId: 53346]}
mkktsrkvvivgtgfvgtsiayaminqgvanelvlidvnqekaegealdlldgmawgekn
vsvwsgtyeecqdanlviltagvnqkpgqtrldlvktnatitrqivkevmasgfdgifvv
asnpvdiltyltwqesglpasrvvgtg
>d3wsva1 c.2.1.0 (A:1-147) automated matches {Enterococcus mundtii [TaxId: 53346]}
mkktsrkvvivgtgfvgtsiayaminqgvanelvlidvnqekaegldgmawgeknvsvws
gtyeecqdanlviltagvnqkpgqtrldlvktnatitrqivkevmasgfdgifvvasnpv
diltyltwqesglpasrvvgtg
Timeline for d3wsva1: