Lineage for d3wcsa_ (3wcs A:)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) 
Family b.29.1.1: Legume lectins [49900] (5 proteins) 
Protein automated matches [190035] (20 species)
not a true protein
Species French bean (Phaseolus vulgaris) [TaxId:3885] [238518] (3 PDB entries) 
Domain d3wcsa_: 3wcs A: [238519]
automated match to d1g8wa_
complexed with ca, edo, mn, nag
Details for d3wcsa_
PDB Entry: 3wcs (more details), 1.75 Å
PDB Description: crystal structure of plant lectin (ligand-bound form)
PDB Compounds: (A:) ErythroagglutininSCOPe Domain Sequences for d3wcsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wcsa_ b.29.1.1 (A:) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
asqtsfsfqrfnetnlilqrdatvsskgqlrltnvndngeptlsslgrafysapiqiwdn
ttgavasfatsftfnidvpnnsgpadglafvllpvgsqpkdkggllglfnnykydsnaht
vavefdtlynvhwdpkprhigidvnsiksiktttwdfvkgenaevlitydsstkllvasl
vypslktsfivsdtvdlksvlpewvivgftattgitkgnvetndilswsfasklsdgt
SCOPe Domain Coordinates for d3wcsa_:
Click to download the PDB-style file with coordinates for d3wcsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3wcsa_:
- d3wcsa_ first appeared in SCOPe 2.03
- d3wcsa_ appears in SCOPe 2.05
- d3wcsa_ appears in the current release, SCOPe 2.08
View in 3D
