Lineage for d3wcsa_ (3wcs A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2779050Species French bean (Phaseolus vulgaris) [TaxId:3885] [238518] (3 PDB entries)
  8. 2779051Domain d3wcsa_: 3wcs A: [238519]
    automated match to d1g8wa_
    complexed with ca, edo, mn, nag

Details for d3wcsa_

PDB Entry: 3wcs (more details), 1.75 Å

PDB Description: crystal structure of plant lectin (ligand-bound form)
PDB Compounds: (A:) Erythroagglutinin

SCOPe Domain Sequences for d3wcsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wcsa_ b.29.1.1 (A:) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
asqtsfsfqrfnetnlilqrdatvsskgqlrltnvndngeptlsslgrafysapiqiwdn
ttgavasfatsftfnidvpnnsgpadglafvllpvgsqpkdkggllglfnnykydsnaht
vavefdtlynvhwdpkprhigidvnsiksiktttwdfvkgenaevlitydsstkllvasl
vypslktsfivsdtvdlksvlpewvivgftattgitkgnvetndilswsfasklsdgt

SCOPe Domain Coordinates for d3wcsa_:

Click to download the PDB-style file with coordinates for d3wcsa_.
(The format of our PDB-style files is described here.)

Timeline for d3wcsa_: