Lineage for d3vwwa_ (3vww A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134369Species Human (Homo sapiens) [TaxId:9606] [188013] (106 PDB entries)
  8. 2134435Domain d3vwwa_: 3vww A: [233873]
    automated match to d4gwra_
    complexed with po4

Details for d3vwwa_

PDB Entry: 3vww (more details), 1.93 Å

PDB Description: Crystal structure of a0-domain of P5 from H. sapiens
PDB Compounds: (A:) Protein disulfide-isomerase A6

SCOPe Domain Sequences for d3vwwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vwwa_ c.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddvieltpsnfnreviqsdslwlvefyapwcghcqrltpewkkaatalkdvvkvgavdad
khhslggqygvqgfptikifgsnknrpedyqggrtgeaivdaalsalrqlvkdrlg

SCOPe Domain Coordinates for d3vwwa_:

Click to download the PDB-style file with coordinates for d3vwwa_.
(The format of our PDB-style files is described here.)

Timeline for d3vwwa_: