Lineage for d4gwra_ (4gwr A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.0: automated matches [191312] (1 protein)
not a true familyProtein automated matches [190056] (165 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188013] (106 PDB entries) 
Domain d4gwra_: 4gwr A: [227687]
automated match to d2e0qa_
Details for d4gwra_
PDB Entry: 4gwr (more details), 1.81 Å
PDB Description: Crystal Structure of the second catalytic domain of protein disulfide isomerase P5
PDB Compounds: (A:) Protein disulfide-isomerase A6SCOPe Domain Sequences for d4gwra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gwra_ c.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvieltddsfdknvldsedvwmvefyapwcghcknlepewaaaasevkeqtkgkvklaav
datvnqvlasrygirgfptikifqkgespvdydggrtrsdivsraldlfsdn
SCOPe Domain Coordinates for d4gwra_:
Click to download the PDB-style file with coordinates for d4gwra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4gwra_:
- d4gwra_ first appeared in SCOPe 2.03
- d4gwra_ appears in SCOPe 2.05
- d4gwra_ appears in SCOPe 2.07
- d4gwra_ appears in the current release, SCOPe 2.08
View in 3D
