Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins) duplication: consists of two clear structural repeats each having this fold |
Protein automated matches [190953] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [193319] (3 PDB entries) |
Domain d3vw9b_: 3vw9 B: [193320] automated match to d1qipb_ complexed with epe, hpj, zn |
PDB Entry: 3vw9 (more details), 1.47 Å
SCOPe Domain Sequences for d3vw9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vw9b_ d.32.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ggltdeaalsccsdadpstkdfllqqtmlrvkdpkksldfytrvlgmtliqkcdfpimkf slyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsdprgfghi giavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywieilnpnkmatlm
Timeline for d3vw9b_: