Lineage for d3vw9b_ (3vw9 B:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) 
Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins)
duplication: consists of two clear structural repeats each having this foldProtein automated matches [190953] (2 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [193319] (3 PDB entries) 
Domain d3vw9b_: 3vw9 B: [193320]
automated match to d1qipb_
complexed with epe, hpj, zn
Details for d3vw9b_
PDB Entry: 3vw9 (more details), 1.47 Å
PDB Description: Human Glyoxalase I with an N-hydroxypyridone inhibitor
PDB Compounds: (B:) lactoylglutathione lyaseSCOPe Domain Sequences for d3vw9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vw9b_ d.32.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggltdeaalsccsdadpstkdfllqqtmlrvkdpkksldfytrvlgmtliqkcdfpimkf
slyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsdprgfghi
giavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywieilnpnkmatlm
SCOPe Domain Coordinates for d3vw9b_:
Click to download the PDB-style file with coordinates for d3vw9b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3vw9b_:
- d3vw9b_ first appeared in SCOPe 2.02
- d3vw9b_ appears in SCOPe 2.06
- d3vw9b_ appears in the current release, SCOPe 2.08
View in 3D
