Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily) beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins) an RNA-binding domain |
Protein automated matches [195910] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [195911] (4 PDB entries) |
Domain d3vkea_: 3vke A: [201246] automated match to d3vkec_ protein/DNA complex; protein/RNA complex |
PDB Entry: 3vke (more details), 1.77 Å
SCOPe Domain Sequences for d3vkea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vkea_ d.51.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hmltirllmhgkevgsiigkkgesvkrireesgarinisegnsperiitltgptnaifka famiidkleedinssw
Timeline for d3vkea_: