SCOPe 2.05: Domain d3vkec_: 3vke C:

Lineage for d3vkec_ (3vke C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
   beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
   an RNA-binding domain

6. Protein automated matches [195910] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [195911] (4 PDB entries)

8. Domain d3vkec_: 3vke C: [195912]
   automated match to d2axyb_
   protein/DNA complex; protein/RNA complex

Details for d3vkec_

PDB Entry: 3vke, 1.77 Å

PDB Description: Contribution of the first K-homology domain of poly(C)-binding protein 1 to its affinity and specificity for C-rich oligonucleotides

PDB Compounds: (C:) Poly(rC)-binding protein 1

SCOPe Domain Sequences for d3vkec_:

Sequence; same for both SEQRES and ATOM records:

>d3vkec_ d.51.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mltirllmhgkevgsiigkkgesvkrireesgarinisegnsperiitltgptnaifkaf
amiidkleed

Timeline for d3vkec_:

• d3vkec_ first appeared in SCOPe 2.02
  
• d3vkec_ appears in SCOPe 2.04
  
• d3vkec_ is called d3vkec1 in SCOPe 2.06
  
• d3vkec_ appears in the current release, SCOPe 2.08, called d3vkec1