Lineage for d3vkea1 (3vke A:14-86)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947085Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2947086Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2947087Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 2947178Protein automated matches [195910] (2 species)
    not a true protein
  7. 2947179Species Human (Homo sapiens) [TaxId:9606] [195911] (4 PDB entries)
  8. 2947180Domain d3vkea1: 3vke A:14-86 [201246]
    Other proteins in same PDB: d3vkea2, d3vkea3, d3vkeb2, d3vkeb3, d3vkec2, d3vked2
    automated match to d3vkec_
    protein/DNA complex; protein/RNA complex

Details for d3vkea1

PDB Entry: 3vke (more details), 1.77 Å

PDB Description: Contribution of the first K-homology domain of poly(C)-binding protein 1 to its affinity and specificity for C-rich oligonucleotides
PDB Compounds: (A:) Poly(rC)-binding protein 1

SCOPe Domain Sequences for d3vkea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vkea1 d.51.1.1 (A:14-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltirllmhgkevgsiigkkgesvkrireesgarinisegnsperiitltgptnaifkafa
miidkleedinss

SCOPe Domain Coordinates for d3vkea1:

Click to download the PDB-style file with coordinates for d3vkea1.
(The format of our PDB-style files is described here.)

Timeline for d3vkea1: