Lineage for d3u5td_ (3u5t D:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1351082Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [226212] (3 PDB entries)
  8. 1351090Domain d3u5td_: 3u5t D: [217204]
    automated match to d1ybva_

Details for d3u5td_

PDB Entry: 3u5t (more details), 2.4 Å

PDB Description: The crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from Sinorhizobium meliloti
PDB Compounds: (D:) 3-oxoacyl-[acyl-carrier-protein] reductase

SCOPe Domain Sequences for d3u5td_:

Sequence, based on SEQRES records: (download)

>d3u5td_ c.2.1.0 (D:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
kvaivtgasrgigaaiaarlasdgftvvinyagkaaaaeevagkieaaggkaltaqadvs
dpaavrrlfataeeafggvdvlvnnagimplttiaetgdavfdrviavnlkgtfntlrea
aqrlrvggriinmstsqvgllhpsygiyaaakagveamthvlskelrgrditvnavapgp
tatdlflegksdevrdrfaklaplerlgtpqdiagavaflagpdgawvngqvlranggii

Sequence, based on observed residues (ATOM records): (download)

>d3u5td_ c.2.1.0 (D:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
kvaivtgasrgigaaiaarlasdgftvvinyagkaaaaeevagkieaaggkaltaqadvs
dpaavrrlfataeeafggvdvlvnnagimplttiaetgdavfdrviavnlkgtfntlrea
aqrlrvggriinmstsqvgllhpsygiyaaakagveamthvlskelrgrditvnavapgp
tvrdrfaklaplerlgtpqdiagavaflagpdgawvngqvlranggii

SCOPe Domain Coordinates for d3u5td_:

Click to download the PDB-style file with coordinates for d3u5td_.
(The format of our PDB-style files is described here.)

Timeline for d3u5td_: