Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [226212] (3 PDB entries) |
Domain d3u5td_: 3u5t D: [217204] automated match to d1ybva_ |
PDB Entry: 3u5t (more details), 2.4 Å
SCOPe Domain Sequences for d3u5td_:
Sequence, based on SEQRES records: (download)
>d3u5td_ c.2.1.0 (D:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]} kvaivtgasrgigaaiaarlasdgftvvinyagkaaaaeevagkieaaggkaltaqadvs dpaavrrlfataeeafggvdvlvnnagimplttiaetgdavfdrviavnlkgtfntlrea aqrlrvggriinmstsqvgllhpsygiyaaakagveamthvlskelrgrditvnavapgp tatdlflegksdevrdrfaklaplerlgtpqdiagavaflagpdgawvngqvlranggii
>d3u5td_ c.2.1.0 (D:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]} kvaivtgasrgigaaiaarlasdgftvvinyagkaaaaeevagkieaaggkaltaqadvs dpaavrrlfataeeafggvdvlvnnagimplttiaetgdavfdrviavnlkgtfntlrea aqrlrvggriinmstsqvgllhpsygiyaaakagveamthvlskelrgrditvnavapgp tvrdrfaklaplerlgtpqdiagavaflagpdgawvngqvlranggii
Timeline for d3u5td_: