Lineage for d3tzud_ (3tzu D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2426782Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2426863Family b.84.1.0: automated matches [191593] (1 protein)
    not a true family
  6. 2426864Protein automated matches [191080] (7 species)
    not a true protein
  7. 2426875Species Mycobacterium marinum [TaxId:216594] [196128] (1 PDB entry)
  8. 2426879Domain d3tzud_: 3tzu D: [196129]
    automated match to d3ifta_
    complexed with act, edo, peg

Details for d3tzud_

PDB Entry: 3tzu (more details), 2.3 Å

PDB Description: crystal structure of a glycine cleavage system h protein (gcvh) from mycobacterium marinum
PDB Compounds: (D:) Glycine cleavage system H protein 1

SCOPe Domain Sequences for d3tzud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tzud_ b.84.1.0 (D:) automated matches {Mycobacterium marinum [TaxId: 216594]}
ipgdrsytadhewidiapgaatpdgpvrvgitsvavealgdlvfvqlpevgetvsagesc
gevestktvsdliapasgqivevntaavddpatiatdpygagwlysvqptavgelltase
yagqngl

SCOPe Domain Coordinates for d3tzud_:

Click to download the PDB-style file with coordinates for d3tzud_.
(The format of our PDB-style files is described here.)

Timeline for d3tzud_: