Lineage for d3ttlb_ (3ttl B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624948Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1624949Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1626115Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1626116Protein automated matches [190039] (87 species)
    not a true protein
  7. 1626559Species Pseudomonas aeruginosa [TaxId:287] [195692] (2 PDB entries)
  8. 1626563Domain d3ttlb_: 3ttl B: [195693]
    automated match to d1a99a_

Details for d3ttlb_

PDB Entry: 3ttl (more details), 2.3 Å

PDB Description: Crystal structure of apo-SpuE
PDB Compounds: (B:) Polyamine transport protein

SCOPe Domain Sequences for d3ttlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ttlb_ c.94.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
slhiynwtdyiapttlkdftkesgidvsydvfdsnetlegklvsghsgydivvpsnnflg
kqiqagafqkldksklpnwknldpallkqlevsdpgnqyavpylwgtngigynvakvkev
lgdqpidswailfepenmkklakcgvafmdsgdemlpaalnylgldpnthdpkdykkaee
vltkvrpyvsyfhsskyisdlangnicvafgysgdvfqaaaraeeagkgidiqyvipkeg
anlwfdlmaipadakaadnayafidyllrpeviakvsdyvgyanaipgarplmdksvsds
eevyppqavldklyvsavlpakvlrlqtrtwtrik

SCOPe Domain Coordinates for d3ttlb_:

Click to download the PDB-style file with coordinates for d3ttlb_.
(The format of our PDB-style files is described here.)

Timeline for d3ttlb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ttla_