Lineage for d3to9a_ (3to9 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968734Protein automated matches [190241] (13 species)
    not a true protein
  7. 2968745Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189801] (3 PDB entries)
  8. 2968748Domain d3to9a_: 3to9 A: [185896]
    automated match to d1fy7a_
    complexed with cad, coa, edo, so4

Details for d3to9a_

PDB Entry: 3to9 (more details), 2 Å

PDB Description: Crystal structure of yeast Esa1 E338Q HAT domain bound to coenzyme A with active site lysine acetylated
PDB Compounds: (A:) Histone acetyltransferase ESA1

SCOPe Domain Sequences for d3to9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3to9a_ d.108.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
evarvrnlnriimgkyeiepwyfspypieltdedfiyiddftlqyfgskkqyeryrkkct
lrhppgneiyrddyvsffeidgrkqrtwcrnlcllsklfldhktlyydvdpflfycmtrr
delghhlvgyfskekesadgynvaciltlpqyqrmgygklliefsyelskkenkvgspqk
plsdlgllsyraywsdtlitllvehqkeitideissmtsmtttdilhtaktlnilryykg
qhiiflnedildrynrlkakkrrtidpnrliwkppv

SCOPe Domain Coordinates for d3to9a_:

Click to download the PDB-style file with coordinates for d3to9a_.
(The format of our PDB-style files is described here.)

Timeline for d3to9a_: