PDB entry 3to9

View 3to9 on RCSB PDB site
Description: Crystal structure of yeast Esa1 E338Q HAT domain bound to coenzyme A with active site lysine acetylated
Class: transferase
Keywords: MYST family, TRANSFERASE
Deposited on 2011-09-04, released 2011-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.22
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase ESA1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ESA1, YOR244W, O5257
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08649 (0-275)
      • engineered mutation (178)
    Domains in SCOPe 2.07: d3to9a_
  • Heterogens: COA, EDO, SO4, CAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3to9A (A:)
    evarvrnlnriimgkyeiepwyfspypieltdedfiyiddftlqyfgskkqyeryrkkct
    lrhppgneiyrddyvsffeidgrkqrtwcrnlcllsklfldhktlyydvdpflfycmtrr
    delghhlvgyfskekesadgynvaciltlpqyqrmgygklliefsyelskkenkvgspqk
    plsdlgllsyraywsdtlitllvehqkeitideissmtsmtttdilhtaktlnilryykg
    qhiiflnedildrynrlkakkrrtidpnrliwkppv