Lineage for d3ssra_ (3ssr A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562704Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2562705Family d.58.56.1: CcmK-like [143415] (4 proteins)
    Pfam PF00936; BMC domain
  6. 2562739Protein automated matches [191074] (7 species)
    not a true protein
  7. 2562778Species Thermosynechococcus elongatus [TaxId:197221] [194973] (3 PDB entries)
  8. 2562779Domain d3ssra_: 3ssr A: [194975]
    automated match to d2a1ba1
    complexed with so4

Details for d3ssra_

PDB Entry: 3ssr (more details), 1.6 Å

PDB Description: ccmk2 dodecamer - form 2
PDB Compounds: (A:) Carbon dioxide concentrating mechanism protein

SCOPe Domain Sequences for d3ssra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ssra_ d.58.56.1 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
iavgmietrgfpavveaadamvkaarvtlvgyekigsgrvtvivrgdvsevqasvaagvd
sakrvnggevlsthiiarphenleyvlpiryteaveqfr

SCOPe Domain Coordinates for d3ssra_:

Click to download the PDB-style file with coordinates for d3ssra_.
(The format of our PDB-style files is described here.)

Timeline for d3ssra_: