Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.56: CcmK-like [143414] (2 families) contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
Family d.58.56.1: CcmK-like [143415] (4 proteins) Pfam PF00936; BMC domain |
Protein automated matches [191074] (7 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [194973] (3 PDB entries) |
Domain d3ssra_: 3ssr A: [194975] automated match to d2a1ba1 complexed with so4 |
PDB Entry: 3ssr (more details), 1.6 Å
SCOPe Domain Sequences for d3ssra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ssra_ d.58.56.1 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} iavgmietrgfpavveaadamvkaarvtlvgyekigsgrvtvivrgdvsevqasvaagvd sakrvnggevlsthiiarphenleyvlpiryteaveqfr
Timeline for d3ssra_: