| Class b: All beta proteins [48724] (178 folds) |
| Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
| Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
| Protein automated matches [190914] (14 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [196227] (11 PDB entries) |
| Domain d3s6nf_: 3s6n F: [196228] Other proteins in same PDB: d3s6na_, d3s6nb_ automated match to d1n9sc_ protein/RNA complex |
PDB Entry: 3s6n (more details), 2.5 Å
SCOPe Domain Sequences for d3s6nf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s6nf_ b.38.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlgev
lircnnvlyirgve
Timeline for d3s6nf_:
View in 3DDomains from other chains: (mouse over for more information) d3s6na_, d3s6nb_, d3s6ne_, d3s6ng_ |