Lineage for d3s6nf_ (3s6n F:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123076Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1123077Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1123517Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 1123518Protein automated matches [190914] (4 species)
    not a true protein
  7. 1123525Species Homo sapiens [TaxId:9606] [196227] (1 PDB entry)
  8. 1123526Domain d3s6nf_: 3s6n F: [196228]
    automated match to d1n9sc_
    protein/RNA complex

Details for d3s6nf_

PDB Entry: 3s6n (more details), 2.5 Å

PDB Description: crystal structure of the gemin2-binding domain of smn, gemin2 in complex with smd1/d2/f/e/g from human
PDB Compounds: (F:) Small nuclear ribonucleoprotein F

SCOPe Domain Sequences for d3s6nf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s6nf_ b.38.1.0 (F:) automated matches {Homo sapiens [TaxId: 9606]}
lplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlgev
lircnnvlyirgve

SCOPe Domain Coordinates for d3s6nf_:

Click to download the PDB-style file with coordinates for d3s6nf_.
(The format of our PDB-style files is described here.)

Timeline for d3s6nf_: