Lineage for d3s26a_ (3s26 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1551687Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1551688Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1551689Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1552080Protein automated matches [190163] (13 species)
    not a true protein
  7. 1552135Species Mouse (Mus musculus) [TaxId:10090] [188249] (10 PDB entries)
  8. 1552142Domain d3s26a_: 3s26 A: [185254]
    automated match to d1ngla_

Details for d3s26a_

PDB Entry: 3s26 (more details), 1.8 Å

PDB Description: crystal structure of murine siderocalin (lipocalin 2, 24p3)
PDB Compounds: (A:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3s26a_:

Sequence, based on SEQRES records: (download)

>d3s26a_ b.60.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nlipapslltvplqpdfrsdqfrgrwyvvglagnavqkktegsftmystiyelqennsyn
vtsilvrdqdqgcrywirtfvpssragqftlgnmhrypqvqsynvqvattdynqfamvff
rktsenkqyfkitlygrtkelspelkerftrfakslglkddniifsvptdqcidns

Sequence, based on observed residues (ATOM records): (download)

>d3s26a_ b.60.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nlipapslltvplqpdfrsdqfrgrwyvvglagnavqkksftmystiyelqennsynvts
ilvrgcrywirtfvpssragqftlgnmhrypqvqsynvqvattdynqfamvffrktsenk
qyfkitlygrtkelspelkerftrfakslglkddniifsvptdqcidns

SCOPe Domain Coordinates for d3s26a_:

Click to download the PDB-style file with coordinates for d3s26a_.
(The format of our PDB-style files is described here.)

Timeline for d3s26a_: