Lineage for d3rlfe_ (3rlf E:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624948Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1624949Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1624950Family c.94.1.1: Phosphate binding protein-like [53851] (42 proteins)
  6. 1625792Protein automated matches [190140] (17 species)
    not a true protein
  7. Species Escherichia coli K-12 [TaxId:83333] [189211] (13 PDB entries)
  8. 1625856Domain d3rlfe_: 3rlf E: [185018]
    Other proteins in same PDB: d3rlfa1, d3rlfa2, d3rlfb1, d3rlfb2, d3rlff1, d3rlff2, d3rlfg_
    automated match to d1anfa_
    complexed with anp, mal, mg, pgv, umq

Details for d3rlfe_

PDB Entry: 3rlf (more details), 2.2 Å

PDB Description: crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp
PDB Compounds: (E:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d3rlfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rlfe_ c.94.1.1 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtritkasas

SCOPe Domain Coordinates for d3rlfe_:

Click to download the PDB-style file with coordinates for d3rlfe_.
(The format of our PDB-style files is described here.)

Timeline for d3rlfe_: