Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (42 proteins) |
Protein automated matches [190140] (17 species) not a true protein |
Domain d3rlfe_: 3rlf E: [185018] Other proteins in same PDB: d3rlfa1, d3rlfa2, d3rlfb1, d3rlfb2, d3rlff1, d3rlff2, d3rlfg_ automated match to d1anfa_ complexed with anp, mal, mg, pgv, umq |
PDB Entry: 3rlf (more details), 2.2 Å
SCOPe Domain Sequences for d3rlfe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rlfe_ c.94.1.1 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]} kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea lkdaqtritkasas
Timeline for d3rlfe_: