SCOPe 2.04: Domain d3rlfb2: 3rlf B:236-372

Lineage for d3rlfb2 (3rlf B:236-372)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.6: MOP-like [50331] (4 families)

5. Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
   probably stems out from the biMOP domain

6. Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)

7. Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)

8. Domain d3rlfb2: 3rlf B:236-372 [200496]
   Other proteins in same PDB: d3rlfa1, d3rlfb1, d3rlfe_, d3rlff1, d3rlff2, d3rlfg_
   automated match to d1q12a1
   complexed with anp, mal, mg, pgv, umq

Details for d3rlfb2

PDB Entry: 3rlf, 2.2 Å

PDB Description: crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp

PDB Compounds: (B:) Maltose/maltodextrin import ATP-binding protein malK

SCOPe Domain Sequences for d3rlfb2:

Sequence; same for both SEQRES and ATOM records:

>d3rlfb2 b.40.6.3 (B:236-372) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepgva

Timeline for d3rlfb2:

• d3rlfb2 first appeared in SCOPe 2.03
  
• d3rlfb2 appears in SCOPe 2.05
  
• d3rlfb2 appears in the current release, SCOPe 2.08