Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (87 species) not a true protein |
Species Bacillus subtilis [TaxId:535025] [189693] (4 PDB entries) |
Domain d3r6ua_: 3r6u A: [184826] automated match to d1sw1a_ complexed with cht |
PDB Entry: 3r6u (more details), 1.61 Å
SCOPe Domain Sequences for d3r6ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r6ua_ c.94.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 535025]} qtikigaqsmseseiiasmlgqliehhtdlktttiknlgsnavqqqalmngeidiaatry tgdaltgtlrmepekdpdkalaltqrefkkrydlkwydsygfdntyaftvskeladqyhl etvsdvkkwapqlklgvdnywmklkgngyqdftktygmtfggtypmqiglvydavksgkm divlaystdgriksyglkmlkddkqffppydcspvvpekvlkehpelegiikkmlgkidt atmqelnyevdgnlkepsvvakeylekhryfe
Timeline for d3r6ua_: