Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (18 species) not a true protein |
Species Corynebacterium glutamicum [TaxId:1718] [226339] (2 PDB entries) |
Domain d3r6sf1: 3r6s F:3-147 [215607] Other proteins in same PDB: d3r6sa2, d3r6sb2, d3r6sc2, d3r6sd2, d3r6se2, d3r6sf2 automated match to d1g6na2 complexed with cmp, hez |
PDB Entry: 3r6s (more details), 2.38 Å
SCOPe Domain Sequences for d3r6sf1:
Sequence, based on SEQRES records: (download)
>d3r6sf1 b.82.3.0 (F:3-147) automated matches {Corynebacterium glutamicum [TaxId: 1718]} gvqeilsragifqgvdptavnnliqdmetvrfprgatifdegepgdrlyiitsgkvklar hapdgrenlltimgpsdmfgelsifdpgprtssavcvtevhaatmnsdmlrnwvadhpai aeqllrvlarrlrrtnasladlift
>d3r6sf1 b.82.3.0 (F:3-147) automated matches {Corynebacterium glutamicum [TaxId: 1718]} gvqeilsragifqgvdptavnnliqdmetvrfprgatifdegepgdrlyiitsgkvklar harenlltimgpsdmfgelsifdpgprtssavcvtevhaatmnsdmlrnwvadhpaiaeq llrvlarrlrrtnasladlift
Timeline for d3r6sf1: