Lineage for d3qu1a_ (3qu1 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606866Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2606867Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2607053Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 2607054Protein automated matches [191055] (20 species)
    not a true protein
  7. 2607160Species Vibrio cholerae [TaxId:666] [189665] (1 PDB entry)
  8. 2607161Domain d3qu1a_: 3qu1 A: [184624]
    automated match to d1bs4a_
    complexed with cl, so4, zn

Details for d3qu1a_

PDB Entry: 3qu1 (more details), 1.8 Å

PDB Description: peptide deformylase from vibrio cholerae
PDB Compounds: (A:) PEPTIDE deformylase 2

SCOPe Domain Sequences for d3qu1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qu1a_ d.167.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
mavleiltapdprlrvqskqvtdvasvqtliddlldtlyatdngiglaapqvgreeaivv
idlsdnrdqplvlinpkvvsgsnkemgqegclsvpdyyadverytsvvvealdregkplr
ietsdflaivmqheidhlsgnlfidylsplkqqmamkkvkkhvknrar

SCOPe Domain Coordinates for d3qu1a_:

Click to download the PDB-style file with coordinates for d3qu1a_.
(The format of our PDB-style files is described here.)

Timeline for d3qu1a_: