![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
![]() | Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
![]() | Family d.167.1.0: automated matches [191587] (1 protein) not a true family |
![]() | Protein automated matches [191055] (3 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:666] [189665] (1 PDB entry) |
![]() | Domain d3qu1a_: 3qu1 A: [184624] automated match to d1bs4a_ complexed with cl, so4, zn |
PDB Entry: 3qu1 (more details), 1.8 Å
SCOPe Domain Sequences for d3qu1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qu1a_ d.167.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]} mavleiltapdprlrvqskqvtdvasvqtliddlldtlyatdngiglaapqvgreeaivv idlsdnrdqplvlinpkvvsgsnkemgqegclsvpdyyadverytsvvvealdregkplr ietsdflaivmqheidhlsgnlfidylsplkqqmamkkvkkhvknrar
Timeline for d3qu1a_: