SCOPe 2.01: Domain d3qu1a_: 3qu1 A:

Lineage for d3qu1a_ (3qu1 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (3 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [189665] (1 PDB entry)

8. Domain d3qu1a_: 3qu1 A: [184624]
   automated match to d1bs4a_
   complexed with cl, so4, zn

Details for d3qu1a_

PDB Entry: 3qu1, 1.8 Å

PDB Description: peptide deformylase from vibrio cholerae

PDB Compounds: (A:) PEPTIDE deformylase 2

SCOPe Domain Sequences for d3qu1a_:

Sequence; same for both SEQRES and ATOM records:

>d3qu1a_ d.167.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
mavleiltapdprlrvqskqvtdvasvqtliddlldtlyatdngiglaapqvgreeaivv
idlsdnrdqplvlinpkvvsgsnkemgqegclsvpdyyadverytsvvvealdregkplr
ietsdflaivmqheidhlsgnlfidylsplkqqmamkkvkkhvknrar

Timeline for d3qu1a_:

• d3qu1a_ is new in SCOPe 2.01-stable
  
• d3qu1a_ appears in SCOPe 2.02
  
• d3qu1a_ appears in the current release, SCOPe 2.08