Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
Protein Major cold shock protein [50283] (4 species) |
Species Bacillus subtilis [TaxId:1423] [50285] (12 PDB entries) |
Domain d3pf5b_: 3pf5 B: [183695] automated match to d1cspa_ protein/DNA complex; protein/RNA complex; complexed with mg |
PDB Entry: 3pf5 (more details), 1.68 Å
SCOPe Domain Sequences for d3pf5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pf5b_ b.40.4.5 (B:) Major cold shock protein {Bacillus subtilis [TaxId: 1423]} mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa anvtkea
Timeline for d3pf5b_: