Lineage for d3pf5b_ (3pf5 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2789773Protein Major cold shock protein [50283] (4 species)
  7. 2789791Species Bacillus subtilis [TaxId:1423] [50285] (12 PDB entries)
  8. 2789795Domain d3pf5b_: 3pf5 B: [183695]
    automated match to d1cspa_
    protein/DNA complex; protein/RNA complex; complexed with mg

Details for d3pf5b_

PDB Entry: 3pf5 (more details), 1.68 Å

PDB Description: Crystal structure of Bs-CspB in complex with rU6
PDB Compounds: (B:) Cold shock protein cspB

SCOPe Domain Sequences for d3pf5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pf5b_ b.40.4.5 (B:) Major cold shock protein {Bacillus subtilis [TaxId: 1423]}
mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
anvtkea

SCOPe Domain Coordinates for d3pf5b_:

Click to download the PDB-style file with coordinates for d3pf5b_.
(The format of our PDB-style files is described here.)

Timeline for d3pf5b_: