PDB entry 3pf5

View 3pf5 on RCSB PDB site
Description: Crystal structure of Bs-CspB in complex with rU6
Class: gene regulation/RNA
Keywords: BETA BARREL, PROTEIN-RNA complex, COLD SHOCK RESPONSE, TRANSCRIPTION REGULATION, TRANSLATION REGULATION, OB fold, cold shock domain, RNA/DNA binding, single-stranded RNA and DNA, cytosol, GENE REGULATION-RNA complex
Deposited on 2010-10-27, released 2011-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.183
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cold shock protein cspB
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU09100, cspA, cspB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pf5a_
  • Chain 'B':
    Compound: Cold shock protein cspB
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU09100, cspA, cspB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pf5b_
  • Chain 'R':
    Compound: hexaribouracil (rU6)
    Species: synthetic, synthetic
  • Chain 'S':
    Compound: hexaribouracil (rU6)
    Species: synthetic, synthetic
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pf5A (A:)
    mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
    anvtkea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pf5A (A:)
    mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
    anvtke
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pf5B (B:)
    mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
    anvtkea
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.