SCOPe 2.05: Domain d3pduc2: 3pdu C:164-287

Lineage for d3pduc2 (3pdu C:164-287)

Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds)

Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
Family a.100.1.0: automated matches [227147] (1 protein)
not a true family
Protein automated matches [226851] (30 species)
not a true protein
Species Geobacter sulfurreducens [TaxId:35554] [233220] (1 PDB entry)
Domain d3pduc2: 3pdu C:164-287 [233221]
Other proteins in same PDB: d3pdua1, d3pdub1, d3pduc1, d3pdud1, d3pdue1, d3pduf1, d3pdug1, d3pduh1
automated match to d2i9pa2
complexed with gol, nap

Details for d3pduc2

PDB Entry: 3pdu (more details), 1.89 Å

PDB Description: crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+

PDB Compounds: (C:) 3-hydroxyisobutyrate dehydrogenase family protein

SCOPe Domain Sequences for d3pduc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pduc2 a.100.1.0 (C:164-287) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
vgqgarmklvvnmimgqmmtalgegmalgrncgldggqllevldagamanpmfkgkgqml
lsgefptsfplkhmqkdlrlavelgdrlgqplhgaatanesfkraraaghadedfaavfr
vlea

SCOPe Domain Coordinates for d3pduc2:

Click to download the PDB-style file with coordinates for d3pduc2.
(The format of our PDB-style files is described here.)

Timeline for d3pduc2: