Lineage for d3p4ea1 (3p4e A:18-171)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) 
Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins) 
Protein automated matches [227043] (2 species)
not a true proteinSpecies Vibrio cholerae [TaxId:666] [225998] (1 PDB entry) 
Domain d3p4ea1: 3p4e A:18-171 [214655]
Other proteins in same PDB: d3p4ea2
automated match to d1clia1
complexed with amp, cit, edo, gol
Details for d3p4ea1
PDB Entry: 3p4e (more details), 1.77 Å
PDB Description: phosphoribosylformylglycinamidine cyclo-ligase from vibrio cholerae
PDB Compounds: (A:) phosphoribosylformylglycinamidine cyclo-ligaseSCOPe Domain Sequences for d3p4ea1:
Sequence, based on SEQRES records: (download)
>d3p4ea1 d.79.4.1 (A:18-171) automated matches {Vibrio cholerae [TaxId: 666]}
dagnalverikgavkrtrrpevmgglggfgalcelptkykhpvlvsgtdgvgtklrlald
mkkhdtigidlvamcvndlivqgaeplffldyyatgkldvdtaaevisgiadgclqagca
liggetaempgmyegedydvagfcvgvvekeeii
Sequence, based on observed residues (ATOM records): (download)
>d3p4ea1 d.79.4.1 (A:18-171) automated matches {Vibrio cholerae [TaxId: 666]}
dagnalverikgavkrtrrpevmgalcelptkykhpvlvsgtdgvgtklrlaldmkkhdt
igidlvamcvndlivqgaeplffldyyatgkldvdtaaevisgiadgclqagcaligget
aempgmyegedydvagfcvgvvekeeii
SCOPe Domain Coordinates for d3p4ea1:
Click to download the PDB-style file with coordinates for d3p4ea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3p4ea1:
- d3p4ea1 first appeared in SCOPe 2.03
- d3p4ea1 appears in SCOPe 2.06
- d3p4ea1 appears in the current release, SCOPe 2.08
View in 3D
