Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries) |
Domain d3ov6a2: 3ov6 A:8-184 [248353] Other proteins in same PDB: d3ov6a1, d3ov6a3, d3ov6a4, d3ov6a5 automated match to d1onqa2 complexed with d12, mk0, nag |
PDB Entry: 3ov6 (more details), 2.5 Å
SCOPe Domain Sequences for d3ov6a2:
Sequence, based on SEQRES records: (download)
>d3ov6a2 d.19.1.0 (A:8-184) automated matches {Human (Homo sapiens) [TaxId: 9606]} vsfhviqifsfvnqswargqgsgwldelqthgwdsesgtiiflhqwskgqfsneelsdle llfrfylfgltreiqdhasqdyskypfevqvkagcelhsggspegffqvafngldllsfq qttwvpspgcgslaqsvchllnhqyegvtetvynlirstcprfllglldagkmyvhr
>d3ov6a2 d.19.1.0 (A:8-184) automated matches {Human (Homo sapiens) [TaxId: 9606]} vsfhviqifsfvnqswargqgsgwldelqthgwdsesgtiiflhqwskgqfsneelsdle llfrfylfgltreiqdhasskypfevqvkagcelhsggspegffqvafngldllsfqqtt wvpspgcgslaqsvchllnhqyegvtetvynlirstcprfllglldagkmyvhr
Timeline for d3ov6a2:
View in 3D Domains from same chain: (mouse over for more information) d3ov6a1, d3ov6a3, d3ov6a4, d3ov6a5 |